Protein Info for CCNA_00751 in Caulobacter crescentus NA1000 Δfur

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 114 to 141 (28 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 338 to 355 (18 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details PF04235: DUF418" amino acids 245 to 407 (163 residues), 143.8 bits, see alignment E=2.4e-46

Best Hits

KEGG orthology group: K07148, uncharacterized protein (inferred from 100% identity to ccs:CCNA_00751)

Predicted SEED Role

"FIG00482015: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6I9 at UniProt or InterPro

Protein Sequence (413 amino acids)

>CCNA_00751 hypothetical protein (Caulobacter crescentus NA1000 Δfur)
MTDTTAPMTEALRPVAKADRHLSLDVLRGLGVMGILAVNAVAFGLPMPVYMSPELSPFGL
AGAEASAWWVVQTFFHYKFITLFSILFGVSILLVGGERTDKARGALLRRRLGWLLVIGLL
HGLLIWFGDILLLYACTGFVALLARSWTPRRLFTVSLTILLLGSALAIAPLFLLESAPAE
LQQKIIAEMNQPGSGVDVAAATAAMRGGLVAALGENFKSWMILQPMSVIVFIWRTGALML
LGMALFKTGFLTGKAKTWVYLLLIALGGAGLAWTGWESSMKLATDFAEPQATGRYNMAYE
FASLPITLGYASLAILLIRSRAIAGLLNPVARLGQMAFTNYLTQSLIMTTIFWSGRGLGL
FGEFNRVELWGCVIAIWALQLIWSPLWLSRFSMGPMEWIWRRLAYGKGLARGA