Protein Info for CCNA_00190 in Caulobacter crescentus NA1000 Δfur

Annotation: acyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03061: 4HBT
  • amino acids 44 to 114 (71 residues), 68.3 bits, E=5.9e-23

Best Hits

Swiss-Prot: 49% identical to Y511_ZYMMO: Uncharacterized acyl-CoA thioester hydrolase ZMO0511 (ZMO0511) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 99% identity to ccr:CC_0190)

MetaCyc: 49% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]

Predicted SEED Role

"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle

MetaCyc Pathways

• firefly bioluminescence (2/14 steps found)
• jasmonic acid biosynthesis (4/19 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Sequence Analysis Tools

See A0A0H3C666 at UniProt or InterPro

Protein Sequence (144 amino acids)

>CCNA_00190 acyl-CoA hydrolase (Caulobacter crescentus NA1000 Δfur)
MDGDAIAANARAETLAEAWEKAEWPQEAPVLRAIAMPSDTNPEGDIFGGWLLSQMDLAAA
SIAFHRAAGRCATIAIDGMTFLSPVFVGDEVSLFAKVVHTGRTSLKVAVEAWRRRRDGEQ
ANKVTEGVFTFVAIDENRKSRPLP