Protein Info for CA264_20745 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 462 to 481 (20 residues), see Phobius details amino acids 487 to 508 (22 residues), see Phobius details amino acids 514 to 537 (24 residues), see Phobius details amino acids 575 to 592 (18 residues), see Phobius details amino acids 604 to 630 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 20 to 630 (611 residues), 428 bits, see alignment E=3.7e-132

Best Hits

KEGG orthology group: K07787, Cu(I)/Ag(I) efflux system membrane protein CusA (inferred from 57% identity to hhy:Halhy_6627)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZ08 at UniProt or InterPro

Protein Sequence (648 amino acids)

>CA264_20745 metal transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MAASKENLLKERIGHTKEISEEERVAIIEQSSRTVGRAVFFSVLIMIISFAPILFLTGQE
RKLFSPLVLTKTFSLIGAAILAITVAPMLTRVLMKGKLIPESRNPVSNFFVRLYRPAARF
SLEWRKSVLAGCVVLLLGSVPFVVNLGTEFMPPLDEGSLLLMPVTLPDVSNSEAKRIMQL
QDKIIKGFPEVENVLGKAGRAYTATDNAPISMIETIIVLKPKKQWRKGLTKDMLIQEMND
KIQIPGVVVGWTMPIINRVNMLSTGIRTDVGIKIYGSNLDSIYAISRQVESTIKGIEGLE
DLYVEQLTGGKYLDIQIRRPDIARYGLNVDDVNMVIESALGGMVLTTTVEGRERFSVNLR
LAQEYRNDLDEIRRIPVQTMAYGVVPLSAVADIKVSEGPPMINSENAMLRGTVLFNVRGR
DMGSVVNEAKERIDEAFKKMPQGYFVEWSGQYENQVRAQQRLSIIIPVVLLIIAFILYIT
FHSFKSVLVVFISVPVALIGGVYSLYFYNVNFSVAVAVGFIALFGVAVSTGVLMIAYMND
TIRKLVKERGNGPQNISLPMLKDAILFGATQRVRPLLMTVLANVLGLIPVLASTGTGSDV
MKPIAIPFVFGLMTATLFVLIVLPVIYNLLKEWELRKQGQLTVLDIEE