Protein Info for CA264_20415 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 2-iminoacetate synthase ThiH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 TIGR02351: thiazole biosynthesis protein ThiH" amino acids 3 to 366 (364 residues), 554.6 bits, see alignment E=4.8e-171 PF04055: Radical_SAM" amino acids 79 to 229 (151 residues), 56.4 bits, see alignment E=4.3e-19 PF06968: BATS" amino acids 256 to 357 (102 residues), 70.9 bits, see alignment E=8.6e-24

Best Hits

Swiss-Prot: 53% identical to THIH_ECOLI: 2-iminoacetate synthase (thiH) from Escherichia coli (strain K12)

KEGG orthology group: K03150, thiamine biosynthesis ThiH (inferred from 76% identity to psn:Pedsa_1380)

MetaCyc: 53% identical to 2-iminoacetate synthase (Escherichia coli K-12 substr. MG1655)
RXN-11319 [EC: 4.1.99.19]

Predicted SEED Role

"2-iminoacetate synthase (ThiH) (EC 4.1.99.19)" (EC 4.1.99.19)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXK5 at UniProt or InterPro

Protein Sequence (369 amino acids)

>CA264_20415 2-iminoacetate synthase ThiH (Pontibacter actiniarum KMM 6156, DSM 19842)
MSFKHIFNQLNWNEIKESIYAKTASDVERALMHPVRSLEDFKALISPAAAPYLEQMAALS
QRLTQKRFGKTIQMYLPMYLSNECQNICTYCGFSLDNPTPRTTLTPEQILKEVEVIKSYG
YDHVLLVTGEANKTVGVEYFKEVLQLIRPYFSHISMEVQPLDRQEYEQLIPLGLNTVLVY
QETYHHEDYKKHHPKGKKSNFTYRLETPDRLGKAGVHKIGLGVLIGLEDWRTDSFFTALH
LQYLERTYWQTKYSISFPRLRPFSGGLTPKVDMNDRELVQLICAYRIFNEEVELSLSTRE
SQHFRNNVVRLGITSISAGSKTDPGGYASGQQALEQFEISDERSPAEIVQMIRNQGYDAI
WKDWDNVLG