Protein Info for CA264_19750 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 12 to 457 (446 residues), 626.2 bits, see alignment E=1.7e-192 PF00478: IMPDH" amino acids 12 to 476 (465 residues), 543.5 bits, see alignment E=3.9e-167 PF00571: CBS" amino acids 97 to 144 (48 residues), 50.8 bits, see alignment 3.5e-17 amino acids 153 to 207 (55 residues), 46.8 bits, see alignment 6.3e-16 PF03060: NMO" amino acids 215 to 375 (161 residues), 33.9 bits, see alignment E=4.9e-12 PF01070: FMN_dh" amino acids 274 to 366 (93 residues), 25.1 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 65% identical to IMDH_AQUAE: Inosine-5'-monophosphate dehydrogenase (guaB) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 75% identity to sli:Slin_1193)

MetaCyc: 44% identical to inosine-5'-monophosphate dehydrogenase 1 monomer (Homo sapiens)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YX78 at UniProt or InterPro

Protein Sequence (489 amino acids)

>CA264_19750 IMP dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MLSDQSKILFEALTYDDVLLLPAYSEVLPHQTDTSSQLTRNIRINIPLVSAAMDTVTEAD
LAIAMAQEGGIGIIHKNMSIKKQAGQVRKVKRSESGMILDPITLNENATLGDAVQIMTEN
KIGGIPIVNDEGRLTGIITNRDLRFQKDLTQPVSAIMTSQNLITAQKGTDLAKAEDILQE
YKIEKLPVVDENGKLAGLITYKDILKKKDRPFACKDEFGRLRVGAAVGVTPDVLDRVKAL
VEAGVDVISVDTAHGHSKGVLDAVRRIKDTFPDVDLIAGNVATAEGAKALADAGADAVKV
GVGPGSICTTRVIAGIGVPQLSAVMEAARGLEGTGVPVIADGGIKFSGDVVKALAGGAST
VMIGSLLAGTEEAPGEMLIYEGRKYKTYRGMGSVEAMEEGSKDRYFQGDEKDSKKLVPEG
IVGRVAYKGLVNEVIYQLAGGLRAGMGYCGTPTINALWDAKMVKISGAGLRESHPHDVQI
MREAPNYSR