Protein Info for CA264_19355 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 50S ribosomal protein L23

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 PF00276: Ribosomal_L23" amino acids 2 to 91 (90 residues), 99.5 bits, see alignment E=5.7e-33

Best Hits

Swiss-Prot: 51% identical to RL23_PELPB: 50S ribosomal protein L23 (rplW) from Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)

KEGG orthology group: K02892, large subunit ribosomal protein L23 (inferred from 61% identity to lby:Lbys_1828)

MetaCyc: 41% identical to 50S ribosomal subunit protein L23 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L23p (L23Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YX63 at UniProt or InterPro

Protein Sequence (95 amino acids)

>CA264_19355 50S ribosomal protein L23 (Pontibacter actiniarum KMM 6156, DSM 19842)
MNVLKRPIITEKYAALHEVGKYAFEVQKDANKVEIKKAVEKMYGVTVDKISTMRALGKKK
TKYTKSGAVTGRTSLIKKAIVTLKEGEVIDFYSGI