Protein Info for CA264_19085 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: RNA polymerase subunit sigma-24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF04542: Sigma70_r2" amino acids 29 to 95 (67 residues), 48.7 bits, see alignment E=1e-16 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 29 to 178 (150 residues), 91 bits, see alignment E=3.1e-30 PF07638: Sigma70_ECF" amino acids 80 to 176 (97 residues), 26.7 bits, see alignment E=9.8e-10 PF08281: Sigma70_r4_2" amino acids 122 to 172 (51 residues), 59.6 bits, see alignment E=3.7e-20 PF04545: Sigma70_r4" amino acids 128 to 171 (44 residues), 36.3 bits, see alignment 6.6e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 47% identity to psn:Pedsa_2364)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YX03 at UniProt or InterPro

Protein Sequence (192 amino acids)

>CA264_19085 RNA polymerase subunit sigma-24 (Pontibacter actiniarum KMM 6156, DSM 19842)
MKLFSKPKSDEEKLIDGCIAGKRDMQRLLYDLYSKKMMAVCLRYAPTTFEAEDIMQDAFV
KVFNNLQTFKRDCPVEFWIRRIMINTALKHLRSKQLLTVSHESEEVANLSADDVNLSGYS
LDELLSMIQSLAPRYRMVFNLYAIEGYNHKEIGEMLGISEGTSKSQYSRARVILQNMLLR
QEENIKEHVISN