Protein Info for CA264_17300 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cation/H(+) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 transmembrane" amino acids 15 to 32 (18 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 19 to 385 (367 residues), 177.5 bits, see alignment E=2e-56

Best Hits

KEGG orthology group: None (inferred from 49% identity to cpi:Cpin_6580)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW29 at UniProt or InterPro

Protein Sequence (689 amino acids)

>CA264_17300 cation/H(+) antiporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MLNKVHLSLPLEEPVVIFTLVLLIILVVPIILGRFRIPGIVGLIVAGVILGPNGFHILSR
DASIELFGTVGLLYIMFQAGLEIDMIDFKKYKVRSLVFGTLTFMIPMVIGTLTFLYLHGY
DIKPAILLASMFAPHTLLAYPIISRLGLSKNEAVTLTIGGTLITDTAVLFVLAVIINSTH
GSTSVGFWVWMVAQMAIFVAVVLWLFPKIAKYMFKQLESEKGAQYIFVLTVVFAAAFLSE
VAGMEAIIGAFLAGLALNPLIPHASALMNRVEFVGNNIFIPFFLISTGMLVDLKVLFTDT
NAILIAVTIIILAPLAKYAAAYVTQKLFKFSVLQRNLIFGLSSAHAAATLAVVLAGFDIG
LLGESALNGAVVLILVSSMVSSFSTEKVGRKLAILESRRKPDISEKPDRILVPIGNPQTI
ESLIDLSVMLKNPSHREPIYPLAVVIDNEHAEEEIYKKNKMLQEAIKHASASDNDVNLVS
KIDVNVSSGILRAIKELMITEVVLGWNAKITTRDRIFGTVLDNLLDNTEQMILVCKIIQP
LNTTGRLIVVVPTNAELERGFMRWIRSVKLLSTQLGAPIVFRGRRRTLNKLKSVIADSKP
TVEAEYAPYNNLNEFATTKSDLQNDDMVIVISARKRTVSYNSNMDYVPRVLSRNYKNNSF
IVIYPEQYPVYQNVPIKPASYSGNEGEDV