Protein Info for CA264_15210 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: outer membrane chaperone Skp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03938: OmpH" amino acids 29 to 168 (140 residues), 116.7 bits, see alignment E=4.9e-38

Best Hits

KEGG orthology group: K06142, outer membrane protein (inferred from 51% identity to sli:Slin_4436)

Predicted SEED Role

"Outer membrane protein H precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUX1 at UniProt or InterPro

Protein Sequence (202 amino acids)

>CA264_15210 outer membrane chaperone Skp (Pontibacter actiniarum KMM 6156, DSM 19842)
MMNKIKLLVVAFFLISFASFAQSNDQPLKIGYTNVEYILLQLPESKQIESDLKTHSTQLE
NQLKGKYAEYEAKLQAYEKGAATMDKTIREDKEKELMNMNNSIQEFQRTAQMSLQQKEKS
LVDPVIAKIDKAIKEVAKESGYTYVISNQALLAGPEDGDISPLVLKKLGVDPSKVQQTPE
PAASTPAATKPATSTKNNKKKN