Protein Info for CA264_14385 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: LD-carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02016: Peptidase_S66
  • amino acids 11 to 126 (116 residues), 131.3 bits, E=2.1e-42
• PF17676: Peptidase_S66C
  • amino acids 169 to 285 (117 residues), 110.7 bits, E=7e-36

Best Hits

KEGG orthology group: K01297, muramoyltetrapeptide carboxypeptidase [EC: 3.4.17.13] (inferred from 49% identity to fjo:Fjoh_1218)

Predicted SEED Role

"Muramoyltetrapeptide carboxypeptidase (EC 3.4.17.13)" (EC 3.4.17.13)

MetaCyc Pathways

• muropeptide degradation (1/4 steps found)
• peptidoglycan recycling I (7/14 steps found)
• peptidoglycan recycling II (3/10 steps found)
• peptidoglycan maturation (meso-diaminopimelate containing) (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.17.13

Sequence Analysis Tools

See A0A1X9YUK7 at UniProt or InterPro

Protein Sequence (297 amino acids)

>CA264_14385 LD-carboxypeptidase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIPALRPGDKIAIVATARKISFPEIEMAVRTFESWGLQVVLGQTIGASYNYFAGDDALRL
QDLQQMLDDESIKAIVCARGGYGTTRIIDQVDFTKFQKQPKWLVGFSDVTALHSHIHNLG
IESIHGIMPLLFPKEGAAASIETLRGALFGEELTYTAAPHPFNRTGTATGQLVGGNLSML
HTLTGTRSDSSTEGKILFLEDLCEYLYHVDRMMVHLDRSGKLANLAGLIIGDMSDMNDTP
VSFVKNAYEIILEHSGKYNYPVCYGFPVGHEPLNLALICGREAKLEVREEGATLFYL