Protein Info for CA264_12705 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: decaheme cytochrome c MtrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF02464: CinA" amino acids 8 to 155 (148 residues), 150.4 bits, see alignment E=1.6e-48 TIGR00199: amidohydrolase, PncC family" amino acids 13 to 153 (141 residues), 136.8 bits, see alignment E=3.2e-44

Best Hits

Swiss-Prot: 38% identical to PNCC_ENTAG: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Enterobacter agglomerans

KEGG orthology group: K03743, (no description) (inferred from 44% identity to shg:Sph21_3731)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTI6 at UniProt or InterPro

Protein Sequence (163 amino acids)

>CA264_12705 decaheme cytochrome c MtrA (Pontibacter actiniarum KMM 6156, DSM 19842)
MNQTELTELVLGLKDKGLTVAFAESCTAGLLAAEFVKAKGASDVLKGSLVVYQPEVKQKL
LGVKKDTLDLYTAESQQVTNEMVMGLQKQLGADISIATTGLAGPGASETEEKPVGTMFVS
FLYDGKAEEFREEFKGNSDSVRKQLVEYILQKLNGVLKQHYDR