Protein Info for CA264_12445 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: UDP-N-acetylglucosamine 2-epimerase (hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to NEUCH_CAMJE: GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (hydrolyzing) (legG) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K01791, UDP-N-acetylglucosamine 2-epimerase [EC: 5.1.3.14] (inferred from 65% identity to tdn:Suden_0597)

MetaCyc: 52% identical to UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-idopyranose C2-epimerase (Escherichia coli O108)
5.1.3.-

Predicted SEED Role

"UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 5.1.3.14)

MetaCyc Pathways

CMP-N-acetylneuraminate biosynthesis II (bacteria) (3/3 steps found)
UDP-N-acetyl-α-D-mannosamine biosynthesis (1/1 steps found)
CMP-N-acetylneuraminate biosynthesis I (eukaryotes) (2/5 steps found)
CMP-diacetamido-8-epilegionaminic acid biosynthesis (3/7 steps found)
superpathway of CMP-sialic acids biosynthesis (3/15 steps found)
superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTG4 at UniProt or InterPro

Protein Sequence (384 amino acids)

>CA264_12445 UDP-N-acetylglucosamine 2-epimerase (hydrolyzing) (Pontibacter actiniarum KMM 6156, DSM 19842)
MKVCVVTGTRAEYGLLFWTLKELQQDPDVDLQICVTGMHLSPEFGLTYKQIEQDGFQIDK
KVEILLSSDTSVGVSKSIGLGVISFSEAFNELKPDLILLLGDRFEAFAAATAAMIGKIPV
AHCHGGEATEGLIDEPIRHSITKMSHIHFTSTEEYRKRVIQLGEQPQNVHSVGALGIENI
NKLALLSRTKFEESIGFRLGDKNVLVTFHPVTLENATAEHQFTELLEALDDLKATKIIFT
KPNADTDGRVIINLIDQYTKKNPEKSIAFVSLGQLRYLSALQFMDAVIGNSSSGLIEVPS
FKTATIDIGDRQRGRIKADSVISCEPNSNSIKNAIEEAFSDSFQERLLHVKNPYGEKDSS
KEIVKVIKNTNLSALLKKKFYDLV