Protein Info for CA264_11465 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF08220: HTH_DeoR" amino acids 6 to 56 (51 residues), 53.5 bits, see alignment 2.4e-18 PF08279: HTH_11" amino acids 6 to 47 (42 residues), 37.8 bits, see alignment 2.2e-13 PF00455: DeoRC" amino acids 75 to 233 (159 residues), 157.9 bits, see alignment E=3.3e-50

Best Hits

Swiss-Prot: 30% identical to CSQR_ECOLI: HTH-type transcriptional repressor CsqR (csqR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 75% identity to phe:Phep_3507)

Predicted SEED Role

"Transcriptional repressor of aga operon" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYI0 at UniProt or InterPro

Protein Sequence (254 amino acids)

>CA264_11465 transcriptional regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MNITERHQVILQKLQEEGRVSIQELSDMLEVSGVTIRKDLKLLEDKNLLFRTRGGGSIHN
PYAIERPINEKEFIHAEEKQKIAKAALSLIRENDSIIIGSGTTVFQLARCLHPTSHLTVI
TPAVKVTLELSSRPNVEVLQLGGLIRPNSSSVAGSQAERTLEGISCGVLFLGVDGIDLDF
GLSITNLAEASLNEKMIDSAQVLVVLADSTKFGRRGLGRVCSLDQVHYIVTDHGVQPSVV
EALEERGIKVIIAK