Protein Info for CA264_11420 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 PF00370: FGGY_N" amino acids 7 to 243 (237 residues), 130.5 bits, see alignment E=8.2e-42 PF02782: FGGY_C" amino acids 333 to 439 (107 residues), 41.2 bits, see alignment E=1.6e-14

Best Hits

Swiss-Prot: 49% identical to YOAC_BACSU: Putative sugar kinase YoaC (yoaC) from Bacillus subtilis (strain 168)

KEGG orthology group: K11216, autoinducer 2 (AI-2) kinase [EC: 2.7.1.-] (inferred from 60% identity to phe:Phep_3504)

Predicted SEED Role

"FIG01232845: hypothetical protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSW8 at UniProt or InterPro

Protein Sequence (486 amino acids)

>CA264_11420 sugar kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAAQDAYMIVDIGTGNVRVAVATPAGEVLCVERDNVHYKTDDKYADALWFDPTALWGQIL
TLAAKALQQVPQVVIKAVTASSQREGVVLLDEEGNAIIGFPNHDHRGREWECMLANKERI
YQLTGRYPSSLFSALKLVGLRERQPALYDKFSTLLSISDWAQYQLSGVKGFEHSQASETQ
LYDVAAKCWSEELCAAFGIESRVLPPLHSSGAILGKVLPVYAQQLQISPETVVVVGGADT
QLAIKSTRPSVDDIVIVSGTTTPVTKIMTDYLVDEQERTWTNRHVEEGCFILETNAGVTG
LNYQRLKEIFYPYESYDVIERELAAAPASQCVASLGSLIADEKSPVIRGGFSFNVPVSHE
LTRACFVRAALWDIACCIKANCEALCQVTGHELDYVWACGGGMQSPMLRQFIATLLNKKV
LLREGFQQASVIGGAFICNQALGIPEGDTPVAEIVYPAAQEHEAQQEEWRSMRRSLRQGD
LREEVV