Protein Info for CA264_10550 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF07732: Cu-oxidase_3" amino acids 29 to 138 (110 residues), 89.5 bits, see alignment E=2.7e-29 PF00394: Cu-oxidase" amino acids 199 to 256 (58 residues), 33.1 bits, see alignment E=8.8e-12 PF07731: Cu-oxidase_2" amino acids 325 to 434 (110 residues), 85.3 bits, see alignment E=5.2e-28

Best Hits

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSH5 at UniProt or InterPro

Protein Sequence (435 amino acids)

>CA264_10550 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKTEAPTTPAITQTGERHLSFELVARQSHIMLHGKPASVLTYNNSFPGPLLELQEGDHVS
VHFTNQLTAPSNLHLHGISMSPEEDKPHQVVAPGESLSYAFTAQAGSAGMYWYHPHAHGS
VTRQLFEGLSGPIIIRGEADKLPALASATEKVLVLHDIQLENGHVAPHTGMDWGRGKEGN
LVLVNGEKMPEMQVPTGLLRLRVLNASSARYYHLGIPGKQLHVIGMDGSFLEKPVAKETL
LLAPGERADMLVEAMEAAPLALLNMPYSRTPAGPSTDTPAGGAILATFAVQGAPAQVELP
GKLVEIPALDLTTAAAHKTLTFGATMQPLQFTIDGKTFDHCRTDLTARAGTLEVWDIVNP
MAMDHPFHLHTFPFQVIAVNGEAVPYRAWKDVVNVPANGSVRIAIPFEGFTGKVMYHCHI
LEHEDLGMMGNLEVL