Protein Info for CA264_08965 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ketoacyl reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00106: adh_short" amino acids 8 to 204 (197 residues), 165.1 bits, see alignment E=2.9e-52 PF08659: KR" amino acids 11 to 175 (165 residues), 47.4 bits, see alignment E=4.5e-16 PF01370: Epimerase" amino acids 11 to 187 (177 residues), 23.5 bits, see alignment E=6.7e-09 PF13561: adh_short_C2" amino acids 14 to 264 (251 residues), 174 bits, see alignment E=8.1e-55

Best Hits

KEGG orthology group: None (inferred from 57% identity to cao:Celal_2826)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRQ5 at UniProt or InterPro

Protein Sequence (271 amino acids)

>CA264_08965 ketoacyl reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MDLKIAGRVAVVTGADSGMGLATAKVLAAEGAKVILTDKTDAELQAAADQVRQQAQSAAD
VVAIQADLTRTEDVQALAEQVKETFGGAHILAHYAGERGAAGDFLKLTDEDWLDTLNVDL
LGAVRVCRAFIPQMQELGWGRVVLVSSENAMQPYEEESPYNAAKAAIVNLAKCLSRAYAH
DGLLINCVSPAFIKTPMTDTMMEQKAKERGTSVDETVQWFLENKRPHIKVNRRGRAEEVA
AVVAFLCSEQASFVNGSNYRIDGGSVETAFG