Protein Info for CA264_08065 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA polymerase III subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00712: DNA_pol3_beta" amino acids 1 to 119 (119 residues), 84.5 bits, see alignment E=1e-27 TIGR00663: DNA polymerase III, beta subunit" amino acids 1 to 368 (368 residues), 299.1 bits, see alignment E=2.2e-93 PF02767: DNA_pol3_beta_2" amino acids 129 to 243 (115 residues), 84.2 bits, see alignment E=1.3e-27 PF02768: DNA_pol3_beta_3" amino acids 246 to 363 (118 residues), 84.7 bits, see alignment E=6.9e-28

Best Hits

KEGG orthology group: K02338, DNA polymerase III subunit beta [EC: 2.7.7.7] (inferred from 70% identity to chu:CHU_1549)

Predicted SEED Role

"DNA polymerase III beta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRA6 at UniProt or InterPro

Protein Sequence (374 amino acids)

>CA264_08065 DNA polymerase III subunit beta (Pontibacter actiniarum KMM 6156, DSM 19842)
MKFIVSSSALLKQLSSINGVVTNNPVVPILENFLFEINNSTLTITASDLETSMITQLPVE
AKENGRIAAPAKILLETLKNLPDQPVTFTIDEETYTIEISSSNGRYKLSGENATDFPRVP
SVQGGNAIEIPSNVLGRAINKTIFAVSNDELRPAMTGIFVQLRSEDVTFVATDGHRLLRY
RRTDVGTDQEASIIVPRKAFTLLKSTLPSEATAVRMEFNQSNAFFSFDNIRMICRLIDER
YPDYENVIPVQNPNKLVIDRADLQSSVKRISIYSNKTTHQIRLKLSGSELQVSAEDLDFS
NEANERLACQYEGEDMEIGFNAKFLMEMLNNIDSDEITFELSTPNRAGLLMPIVNEEAED
VLMLVMPVMLNNYV