Protein Info for CA264_07170 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 404 to 421 (18 residues), see Phobius details amino acids 484 to 501 (18 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 11 to 496 (486 residues), 435.3 bits, see alignment E=1.5e-134 PF07690: MFS_1" amino acids 17 to 409 (393 residues), 203.9 bits, see alignment E=5.4e-64 PF06609: TRI12" amino acids 31 to 289 (259 residues), 24.8 bits, see alignment E=1.1e-09 PF00083: Sugar_tr" amino acids 44 to 321 (278 residues), 25.6 bits, see alignment E=8.3e-10

Best Hits

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 78% identity to phe:Phep_4262)

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQV2 at UniProt or InterPro

Protein Sequence (515 amino acids)

>CA264_07170 MFS transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MAETGIKKWLITITVITASLLELIDTTIVNVAMPQIQGNLGATLEDIAWVVTGYAVANVI
VLPMSGWLGGRFGRKNYFMASIIIFTVTSFLCGNAANFDELVIFRIIQGLAGGGLLSTAQ
SILLETWPREQVGTATALFGLGAVVGPTLGPTIGGYITDNYSWPWIFYVNIPVGILAAFA
TYLFVKPTEKESKGAPVDWWGIALLALAVGSLQTLLEKGESEDWFETGYIVVLAVMAVLG
AILFIWRELSTDHPIVNLKILKHRSFSIGMFTSFVLGFGLYGSMFVFPIFCQNLLGFTAQ
QTGQLLLPGGLCTIIMMPFVGKMLQRGVPAQFMATMGMFLFFVFSWMLSNSNLLSGTGDF
FWPLVIRGIGMSLLFVPLTTLAVQDLHGKEIGQGTGLNNMSRQLGGSFGIAALTTLIHVR
QGVHRNDLLVNINEYNTAFMQRFNGLIQTFVSKGYSLIDAKTAAYKAIEGMVTKQTYLLT
YTDAYWVAGLIMLFSIPLLYLQKFKKNTNVPTDVH