Protein Info for CA264_06830 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 43 to 67 (25 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 198 to 213 (16 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 54 to 255 (202 residues), 38.6 bits, see alignment E=3.9e-14

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 57% identity to hhy:Halhy_5483)

Predicted SEED Role

"Nitrous oxide reductase maturation transmembrane protein NosY" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQM7 at UniProt or InterPro

Protein Sequence (255 amino acids)

>CA264_06830 ABC transporter permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MNKIIKYVLYDIIRSKIVLAYTLFLLLLSIGLFNLGGSTDKAILSLLNLVLLTVPLISIV
FATTHFYNSYEFMELLVAQPINRKKIFMSEYLGVALSLSAAFILGVGVPVLLFGASVTGL
YLVLTGVFITFIFVALAFLASVITRDKAKGIGIALLLWFYFALIYDGIVLFILYYFADYP
LEQASLALTALNPIDLGRIMVLLKLDVSALMGYTGALYKSIFGSIWGVGLAFGMLLVWVL
VPLLSSGKIFSKRDL