Protein Info for CA264_06275 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 34 to 61 (28 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 163 to 188 (26 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 349 to 374 (26 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details PF00654: Voltage_CLC" amino acids 78 to 408 (331 residues), 229.6 bits, see alignment E=3.1e-72

Best Hits

Swiss-Prot: 53% identical to ERIC_PSESM: Chloride/fluoride channel protein (eriC) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 61% identity to hhy:Halhy_0829)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQE2 at UniProt or InterPro

Protein Sequence (447 amino acids)

>CA264_06275 chloride channel protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKNNTPSPFKSNLKHLLRRALSASEQATAVLYLLKWLLICVLVGVLAGSASAFFLVSLGW
VTAYREAHTWIIAFLPLGGLAIGLLYHYYGGRANGGNNLLLEEIHRPRKVVPFKMAPLVF
AGTLVTHLFGGSAGREGTAVQMGGTVADQFSYLFRLRPRDRKLLLIAGISAGFSSLFGTP
LAGAVFGLEVFVLGRIRYEALLPSFLAAVVANYTCLAWGVGHTHYSIPFVPPLTASGIGY
TLAAGAVFGLAGMAFAKTTSFFTKQFKQQVAFAPYRPLVGGAVVAATVWLMGTTKYIGLG
LPTIINAFEQPLPWYDSAVKLVLTAFTLGAGFKGGEVTPLFYTGATLGNALSGAIPLPVA
LLAGMGFVAVFSGATNTPLTCTIMAIELFGAGSAEYMALACVTAYLFSGHSGIYGSQIIG
SPKHMFYGRLKGKTLTAARDAQAKKTR