Protein Info for CA264_05605 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: RlmI/RlmK family 23S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF17785: PUA_3" amino acids 7 to 68 (62 residues), 75.8 bits, see alignment E=4.6e-25 PF02475: Met_10" amino acids 142 to 304 (163 residues), 31.1 bits, see alignment E=5.1e-11 PF10672: Methyltrans_SAM" amino acids 171 to 350 (180 residues), 75.8 bits, see alignment E=8.8e-25 PF03602: Cons_hypoth95" amino acids 216 to 323 (108 residues), 36.1 bits, see alignment E=1.4e-12 PF05175: MTS" amino acids 224 to 337 (114 residues), 27.4 bits, see alignment E=6e-10

Best Hits

Swiss-Prot: 37% identical to RLMI_SHIFL: Ribosomal RNA large subunit methyltransferase I (rlmI) from Shigella flexneri

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 56% identity to bvu:BVU_3623)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPZ2 at UniProt or InterPro

Protein Sequence (394 amino acids)

>CA264_05605 RlmI/RlmK family 23S rRNA methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSLTKLYLAPGKEHSLKRQHPWVFSGAIRKADGELAEGDVVEVYSSKREFLGMGHYAPGS
IAVRIFSFEQAEPDYAFWKQKVQKAYDYRQRLGLVNNPNTDVYRLVYAEGDGVPGLIVDF
YKDTAVVQTHTVGMYSVRGHVSQALQEIYGDRLRAVYDKSAESLPPKAPVEAQNGYLYGQ
SEGGVVVTENGNRFYIDWETGQKTGFFIDQRENRDLLARYVQGKAVLNTFCYTGGFSVYA
LNAGAKEVHSVDVSKKAIELTVKNGELSQAPEKHEAYAVDTFEFLKGKEDMYDVIVLDPP
AFAKSQKVRHNALMGYKRLNAEAMKKIKPGGILFTFSCSQVVDKYLFNNTIMAAAIEAGR
NIKIMHHLSQPADHPISIFHPEGEYLKGLVLFVE