Protein Info for CA264_04965 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: dihydrofolate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR01499: bifunctional protein FolC" amino acids 29 to 430 (402 residues), 378.5 bits, see alignment E=2.6e-117 PF08245: Mur_ligase_M" amino acids 51 to 266 (216 residues), 41.7 bits, see alignment E=1.3e-14 PF02875: Mur_ligase_C" amino acids 304 to 421 (118 residues), 56 bits, see alignment E=7.7e-19

Best Hits

KEGG orthology group: K11754, dihydrofolate synthase / folylpolyglutamate synthase [EC: 6.3.2.12 6.3.2.17] (inferred from 52% identity to phe:Phep_1166)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.12 or 6.3.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPM7 at UniProt or InterPro

Protein Sequence (431 amino acids)

>CA264_04965 dihydrofolate synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTYQECLDYLYQQLPMYQRIGNAAFKKSLDNITALCEALGQPHQQFKSVHVAGTNGKGSS
SHMLAAVLQEAGYKTGLYTSPHLKSFTERVRVNGQELPQEYLIRFVAKHKALFERVKPSF
FEMTVALAFQYFAEEQVDVAVIEVGLGGRLDSTNIITPELSLITNISYDHQSMLGDTLGA
IAAEKAGIIKPNVPVVISTRQQEAEEVFVAKAAEVGAGLYFAPDHFRLERTDSDLQRQVF
QVYCDEALYLQGLELDLSGVYQKYNLPGVLQALAVLQEQKGYVVPESAVRKGLAHTKRIT
GLKGRWQVLQQAPLTICDTGHNEDGVKQILQGLEVLQPKQVHMVFGAVNDKDVIKILQLL
PQTYAYYFCQADIPRALPVQELLQKAASVGLQGEGYATVASALAAARANAAPDEVIFIGG
STFVVAEIDEL