Protein Info for CA264_04920 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tyrosine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 TIGR00234: tyrosine--tRNA ligase" amino acids 2 to 433 (432 residues), 380.5 bits, see alignment E=5.6e-118 PF00579: tRNA-synt_1b" amino acids 31 to 328 (298 residues), 265 bits, see alignment E=4.4e-83

Best Hits

Swiss-Prot: 65% identical to SYY_CYTH3: Tyrosine--tRNA ligase (tyrS) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 66% identity to sli:Slin_1102)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPP8 at UniProt or InterPro

Protein Sequence (434 amino acids)

>CA264_04920 tyrosine--tRNA ligase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNLIEELRWRGMLHDFMPGTEEQLASEMTSGYIGFDPTAKSLHIGNLATIMLLVHLQRAG
HKPFALVGGATGMIGDPSGKSAERNLLDEETLRGNQEGIKKQLEKFLDFDCGTNSAEIVN
NYDWFKDFSFLGFLREVGKHITVNYMMSKDSVKKRINADEEGDRAEGLSYTEFAYQLIQG
YDFYHLYKNKGLKLQMGASDQWGNITTGTELIRRMDGGKAFALVGKLVTKSDGTKFGKSE
GGNVWLDPNLTSPYKFYQFWLNLSDEEAEKLIKVYTLLPQEEIEKITEEHKQAPHQRLLQ
KALAKDVTIRVHSEEDYNAAVDASEILFGKGDLETLKGLKEDVLLSVFEGVPQIQVSQAD
YASAANVTDLLSDLSGGQVFESKGEAKRMIKNGGVSVNRQKVQHAEEPVSFELLQGKYLV
VQKGKKNYYLISVN