Protein Info for CA264_04890 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: thioredoxin-disulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 TIGR01292: thioredoxin-disulfide reductase" amino acids 7 to 306 (300 residues), 394.5 bits, see alignment E=1.1e-122 PF07992: Pyr_redox_2" amino acids 7 to 295 (289 residues), 159.6 bits, see alignment E=3e-50 PF13738: Pyr_redox_3" amino acids 85 to 278 (194 residues), 58.3 bits, see alignment E=1.9e-19 PF00070: Pyr_redox" amino acids 149 to 220 (72 residues), 50 bits, see alignment E=9e-17

Best Hits

Swiss-Prot: 54% identical to TRXB_RICBR: Thioredoxin reductase (trxB) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 74% identity to chu:CHU_1778)

MetaCyc: 48% identical to thioredoxin reductase (Escherichia coli K-12 substr. MG1655)
Thioredoxin-disulfide reductase. [EC: 1.8.1.9]

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXR8 at UniProt or InterPro

Protein Sequence (312 amino acids)

>CA264_04890 thioredoxin-disulfide reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEIEKVKCLIIGSGPAGYTAAIYASRAGLNPILYQGLQPGGQLTITNDVENYPGYPEGVM
GPEMMEDFKKQAERFGTDVRYGIATAVDFSSQPHKVVIDDQKTIEADAVIISTGASAKWL
GMESESRLNGNGVSACAVCDGFFYRGQDVAIVGAGDTAAEEATYLSNLCNKVYMLVRREE
MRASTIMQERVLNTKNIEVLWNTVTDEILGEDTVEAVRVKNAVTGEMREIPVKGFFVAIG
HKPNSDIFAEYLNLDENGYIRTIPGTAKTNIDGVFACGDVQDFTYRQAVTAAGSGCMAAL
DAERYLASKGLH