Protein Info for CA264_04690 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 30S ribosomal protein S1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 PF00575: S1" amino acids 41 to 107 (67 residues), 24.5 bits, see alignment E=4.4e-09 amino acids 123 to 191 (69 residues), 32.4 bits, see alignment E=1.5e-11 amino acids 209 to 280 (72 residues), 69 bits, see alignment E=5.7e-23 amino acids 294 to 367 (74 residues), 68.9 bits, see alignment E=6.2e-23 amino acids 383 to 456 (74 residues), 55.6 bits, see alignment E=8.8e-19 PF23459: S1_RRP5" amino acids 386 to 446 (61 residues), 28.6 bits, see alignment 2.5e-10

Best Hits

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 74% identity to mtt:Ftrac_0855)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPN2 at UniProt or InterPro

Protein Sequence (627 amino acids)

>CA264_04690 30S ribosomal protein S1 (Pontibacter actiniarum KMM 6156, DSM 19842)
MSNSPENFDWDKFESQGFGAGYSKAEKAEMEKMYDDTLTTVQEQEVVTGTVVGVTDRDVI
LNIGFKSDGLVSISEFRDMPDLKPGDQVEVFIEDQEDPNGQLILSRKKAKIVSAWARIYD
ALENDNVLEGVVKRRTKGGLIMDIHGVEAFLPGSQIDVKPIRDFDVFVGKKMEVKVVKIN
AAFDNVVVSHKVLIEKDLEQQRAAILNNLEKGQVLEGVIKNMTNFGVFIDLGGVDGLLHI
TDISWGRINHPEEVLQLDQKVNIVVLDFDEDKKRISLGMKQLTPHPWDALPAEIEVGSRV
KGKIVNVADYGAFLELMPGVEGLIHVSEMSWSQHLRNPQDFIKQGDEVEAVVLTLDRQER
KMSLGIKQLTEDPWTKEDVLTKYAIGTKHTGIVRNLTNFGLFLELEEGVDGLVHVSDLSW
TKKIKHPSEFVKVGENLDVVVLELDVPNRRLALGHKQLEENPWDTFESVFNIGSVHKATV
LEKSDRGAVLELPYGIEGFSFPKGLTKEDGSQVEAGETLDFRVTEFSKEDRKIILSHTAT
HTEVEPSPRAAKATKKAAPAGEKKEARAPKVQKEADRSTLGDLDALSALKEQMLENEKEA
GVKKLEAAAKKSKDSNEGEVSEEENNA