Protein Info for CA264_04530 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: alpha-ketoacid dehydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02779: Transket_pyr
  • amino acids 3 to 178 (176 residues), 156.1 bits, E=1.1e-49
• PF02780: Transketolase_C
  • amino acids 193 to 313 (121 residues), 140.4 bits, E=4.2e-45
• PF17147: PFOR_II
  • amino acids 203 to 279 (77 residues), 27.5 bits, E=5.1e-10

Best Hits

Swiss-Prot: 58% identical to ODPB_RICFE: Pyruvate dehydrogenase E1 component subunit beta (pdhB) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 83% identity to sli:Slin_5165)

MetaCyc: 53% identical to pyruvate dehydrogenase E1 component beta subunit (Homo sapiens)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (2/4 steps found)
• pyruvate fermentation to acetate II (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

See A0A1X9YPK1 at UniProt or InterPro

Protein Sequence (327 amino acids)

>CA264_04530 alpha-ketoacid dehydrogenase subunit beta (Pontibacter actiniarum KMM 6156, DSM 19842)
MRSIQFREALREAMSEEMRRDKSVFLMGEEVAEYNGAYKVSQGMLDEFGPERVIDTPIAE
LGFAGIGVGAAMNGLRPIIEFMTFNFSLVAIDQVINSAAKLMSMSGGQYGAPMVFRGPTG
SAGMLSSQHSQNFENWYANTPGLKVVVPSNPYDAKGLLKAAIRDNDPVIFMESEQMYGDK
GEVPEEEYILPIGVADIKREGSDVTIVSFGKMMKVALAAAEELAKDGINAEVIDLRTVRP
IDYKTLIESVKKTNRMVVVEEAWPLASISSEIAYHIQSNAFDYMDAPVKRVTCRDVPLPY
APTLIDASLPNVERTIEAVKKVMYKKA