Protein Info for CA264_04510 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA ligase (NAD(+)) LigA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 PF22745: Nlig-Ia" amino acids 6 to 66 (61 residues), 71.4 bits, see alignment 2.1e-23 TIGR00575: DNA ligase, NAD-dependent" amino acids 14 to 664 (651 residues), 829.6 bits, see alignment E=9.4e-254 PF01653: DNA_ligase_aden" amino acids 71 to 317 (247 residues), 313.9 bits, see alignment E=3.7e-97 PF03120: OB_DNA_ligase" amino acids 321 to 397 (77 residues), 111.3 bits, see alignment E=7.9e-36 PF03119: DNA_ligase_ZBD" amino acids 406 to 432 (27 residues), 38.3 bits, see alignment (E = 4.2e-13) PF14520: HHH_5" amino acids 448 to 501 (54 residues), 28 bits, see alignment 1.1e-09 amino acids 514 to 564 (51 residues), 17.7 bits, see alignment 1.9e-06 PF12826: HHH_2" amino acids 509 to 572 (64 residues), 81 bits, see alignment E=2.5e-26 PF00533: BRCT" amino acids 593 to 668 (76 residues), 59.2 bits, see alignment E=1.7e-19 PF12738: PTCB-BRCT" amino acids 605 to 660 (56 residues), 26.8 bits, see alignment 1.9e-09

Best Hits

Swiss-Prot: 58% identical to DNLJ_CYTH3: DNA ligase (ligA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01972, DNA ligase (NAD+) [EC: 6.5.1.2] (inferred from 60% identity to mtt:Ftrac_0818)

MetaCyc: 44% identical to DNA ligase (Escherichia coli K-12 substr. MG1655)
DNA ligase (NAD(+)). [EC: 6.5.1.2, 6.5.1.6]

Predicted SEED Role

"DNA ligase (EC 6.5.1.2)" in subsystem DNA Repair Base Excision (EC 6.5.1.2)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.2 or 6.5.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPK7 at UniProt or InterPro

Protein Sequence (669 amino acids)

>CA264_04510 DNA ligase (NAD(+)) LigA (Pontibacter actiniarum KMM 6156, DSM 19842)
MATAKDPALEIQELTQQINHLNYQYYQNSVSEVSDYDFDQLLKRLEALEAQYPELRLPHS
PTQRVGGTVTKNFDTVYHKWPMLSLSNTYSEEELREFDKRVRKVVGDEVEYVCEQKFDGV
AISLTYENGKFVQGATRGDGTRGDNITANVRTIHDVPLQAHGEGFPELFEVRGEVFMPFQ
VFEQLNVEREEAGEQLLANPRNATSGTLKQQDSAVVASRKLGCFSYSFHTDKTLFDTHSE
SLQAIQKWGFKVSETWRKCGSIDDVMAYINEWETRRHELPIATDGVVVKVNSYALQEELG
FTSKSPRWAIAYKYAAENSATKLIDIQYQVGRTGAVTPVALLEPVALAGTTVKRASVHNA
NEIQRLDLRLGDTVFVEKGGEIIPKITGVDLDKRPADSQPILYPTHCPACETELVRSEGE
ANFYCPNDKGCPPQIKAKLEHFISRKAMNIDGLGPETIEQLYATGLVTNAADLYDLTFEQ
LVQLERMGEKSANNILKSLEKSKEAPYDRVLFALGIRFVGSTVAKKLAQDLPDLEALRGA
TFEELVAINEIGERIARSILAYFQDPDHVQLVERLKAAGLNFKSENKAPEIQSNKLEGQT
FVISGVFESVSRDELQQLIVSHGGKVVSSISKKLSYLVAGDKMGPSKLEKAETLGIKILS
EAEFLSMIG