Protein Info for CA264_04170 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details PF01545: Cation_efflux" amino acids 13 to 217 (205 residues), 128.5 bits, see alignment E=1.4e-41 TIGR01297: cation diffusion facilitator family transporter" amino acids 13 to 299 (287 residues), 148.3 bits, see alignment E=1.4e-47

Best Hits

KEGG orthology group: None (inferred from 60% identity to npu:Npun_F1794)

Predicted SEED Role

"Cation transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPB1 at UniProt or InterPro

Protein Sequence (310 amino acids)

>CA264_04170 cation transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MNVKPSKLPLYGALAANLAIAIIKFIAAVISGSSAMLSEGIHSLVDTGNSLLLLLGLSKS
QKPADVGHPFGHGKELYFWSLIVAILIFAVGGGMSIYEGIMHLQNPSPLEDPTLSYIILV
VAMVFEGIAWTIAYKNFSKTRVEKNFLRALRASKDPATFTVLFEDSAAIMGLAVAFLGVF
LSHQLNNPYFDGLASVVIGLILAGVAVLLASESKGLLIGEAASHRTVESINSIANADPAV
ERIAPPLTMHLGPYEVLLAIEVDFQDELSATEIENAIARLEAAVFEKHPEVKRIFIEAKS
ITAKRVRGTL