Protein Info for CA264_04080 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 TIGR00229: PAS domain S-box protein" amino acids 314 to 441 (128 residues), 38.9 bits, see alignment E=4.2e-14 PF00989: PAS" amino acids 317 to 432 (116 residues), 29.8 bits, see alignment E=1.3e-10 PF08448: PAS_4" amino acids 322 to 436 (115 residues), 44.8 bits, see alignment E=3.3e-15 PF13426: PAS_9" amino acids 328 to 434 (107 residues), 26.8 bits, see alignment E=1.3e-09 PF00512: HisKA" amino acids 457 to 524 (68 residues), 39.1 bits, see alignment E=1.6e-13 PF02518: HATPase_c" amino acids 571 to 675 (105 residues), 83.7 bits, see alignment E=3.1e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY16 at UniProt or InterPro

Protein Sequence (676 amino acids)

>CA264_04080 PAS domain-containing sensor histidine kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MGALMRTYDWSSHPLGNPAYWPQSLKANVRLMLNSGFPMFIWWTKELYMFNNDAYLPALG
KKHPKALGARAQDMWAEIWEQIGGITKDILEHGNEFYAENLQMFLERKGFAEETYWTFSY
SPAFNDAGEVEGIFCACSEVTTNVLAQRRLKTLNDVSDALLQVQTLEQAGQTACHVLAQN
QHDLPFSLIYLINGTDTEAQLVGKSGTVPAGFAPQLVDLRKRKAAFPLAQVQRTRQRALV
TLPSVDPSLPGTPAKAVILPILRPGHEQLIGFFVAGLSPQQEYNEAYKGFHSLVAGQIAT
SITGIRTKQELLRRQEYLSEIFQQAPVGITMLRGPQYIVDIANPAVCEIWRISQEEILGK
PVLEAIPEAGEQGFKELLDGVMNTGVPFVANELPLVLERNGKPEKVYLNFVYHPLRDAQG
FITGIIAVAIDISEQVEARQEMESINRELLATNADLDNFVYSASHDLKAPIYNIEGLVHA
LQEHLPHDASASEEVQQLLTHIESSVERFKKVVSDLTQVAKIQREGSEDVSAIDLEEVMT
ELREEFELTLAASEAQLETDLTAATIRFSAKNIRSILYNLLSNALKYRSPERKPHITVKT
VNTPEHLVLSVTDNGLGIEQSDYKKVFSMFKRLHDHVEGSGIGLYIVKRIVENAGGYIRI
HSEVGKGTTFSIYFKR