Protein Info for CA264_03580 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ATP-dependent helicase HrpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 815 TIGR01970: ATP-dependent helicase HrpB" amino acids 10 to 813 (804 residues), 891.4 bits, see alignment E=3.3e-272 PF00270: DEAD" amino acids 22 to 167 (146 residues), 52.6 bits, see alignment E=9.7e-18 PF00271: Helicase_C" amino acids 213 to 333 (121 residues), 40.7 bits, see alignment E=5e-14 PF24473: CON_HrpB" amino acids 585 to 619 (35 residues), 36.1 bits, see alignment (E = 9e-13) PF08482: HrpB_C" amino acids 683 to 813 (131 residues), 94.8 bits, see alignment E=1.1e-30

Best Hits

KEGG orthology group: None (inferred from 56% identity to chu:CHU_2491)

Predicted SEED Role

"ATP-dependent helicase HrpB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNY1 at UniProt or InterPro

Protein Sequence (815 amino acids)

>CA264_03580 ATP-dependent helicase HrpB (Pontibacter actiniarum KMM 6156, DSM 19842)
MPFNPFTIDLPVREIIPAVREHLAAQNTLIVNAPPGAGKSTLLPLAILDEVWLTGQKIVM
LEPRRLAAKTIAERLAQLLGEEVGQSVGYRIRFETRISERTRIEVVTEGILTRMIHSDRA
LTGIGIVIFDEFHERSIHADVAMALSREAQHTLRPDLRIMVMSATLDMPQLTSLLKAPVA
QSMGRQYPIETHYTGDADDRMLPEMTAKVIKQAAQEQEGDILVFLPGEGDIRKVETILRR
ELRNFQIHPLFGMLPFGKQYAAIMPDRQGRRKVVLATSIAETSLTIEGISVVVDTGFGKT
SRFDPKSGLSRLETVRISKDAADQRAGRAGRLGPGTAYRMWSKTTHERMAPHRTPEIMEA
DLSSLVLDMAQWGITDIRGLTWLNPPPRAALQYATDMLHQLQALEHGRITEHGKRMHALP
CHPRIAHMLLKAEETDQVALASDIASVLEERDPLDRNAGIDINLRVEALRRYRKEQGQGK
RFSKIEKIARSYRSLFEVDPENGSFDDYETGVLLAHCYPERIAYARPGNNAQFQLASGQY
ASAGHRDDLAHESWLAIAHLHAGTGDNPGRIFLASPLNPRDLAPLVKQQESYHWDVNDGE
LTASMDTRIGSIVLQSKPLPPPDEKHRIPAISEAIKLEGEHLLDFNEELTQWQNRVLSLR
KWRPAEGWPDVSTSTLLMTNWDWLRPHLSDIEHPDELMELELLPILEKKYLDEAQRERLE
VLAPASINLLDGSSIELEYKAQGEQPKLEIRLQDILAWEESPTVDAGEMKVELHLLTPEL
KPITTVSDLASFWKGNYRVIKRQLEAVFPEVKWER