Protein Info for CA264_03260 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MBL fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF00753: Lactamase_B" amino acids 13 to 132 (120 residues), 61 bits, see alignment E=2.4e-20 PF23023: Anti-Pycsar_Apyc1" amino acids 21 to 72 (52 residues), 34.4 bits, see alignment 3e-12 PF12706: Lactamase_B_2" amino acids 26 to 206 (181 residues), 75.6 bits, see alignment E=6.1e-25

Best Hits

KEGG orthology group: None (inferred from 71% identity to sli:Slin_1050)

Predicted SEED Role

"Metal-dependent hydrolases of the beta-lactamase superfamily I" in subsystem Beta-lactamase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNW1 at UniProt or InterPro

Protein Sequence (280 amino acids)

>CA264_03260 MBL fold hydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQLYITSLNSGSNGNCYYVGNHREAILVDAGISCRETEKRMKRLGLSLARVKAIFISHEH
SDHIRGIAVLAKKYNLPVYITLATLQNARLDLGDVQVIPFSADEPVQVGGLTVTAFVKRH
DAADPHSFVVGYKGINVGVFTDIGAPCDNLIHHFQQCHAAFLEANYDEDLLERGRYPYYL
KNRIRGGRGHLSNRQALALFAGYKPAFMSHLLLAHLSKDNNCPNLVRELFTAHADGTEIT
VASRFEETPVFRITGSFSRQAATTVGQGQISLDFGEVALH