Protein Info for CA264_02580 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 PF13601: HTH_34" amino acids 17 to 95 (79 residues), 110.2 bits, see alignment E=2.2e-36

Best Hits

Swiss-Prot: 38% identical to Y432_METJA: Uncharacterized protein MJ0432 (MJ0432) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 69% identity to sli:Slin_1184)

Predicted SEED Role

"Bsl7504 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNF7 at UniProt or InterPro

Protein Sequence (102 amino acids)

>CA264_02580 transcriptional regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MKDYLDNINKAFESRARLGIMSVLMVEDKADFNTLKETLQLTDGNLASHLRALEEAAYLR
VEKQFVGRKPNTTYHATEAGREAFNSHLDALEQLILSNRKDS