Protein Info for CA264_02115 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: threonylcarbamoyl-AMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 9 to 206 (198 residues), 204.7 bits, see alignment E=4.4e-65 PF01300: Sua5_yciO_yrdC" amino acids 25 to 200 (176 residues), 170.5 bits, see alignment E=1.3e-54

Best Hits

Swiss-Prot: 42% identical to Y1198_HAEIN: Uncharacterized protein HI_1198 (HI_1198) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07566, putative translation factor (inferred from 65% identity to phe:Phep_3021)

Predicted SEED Role

"Hypothetical YciO protein, TsaC/YrdC paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNA3 at UniProt or InterPro

Protein Sequence (208 amino acids)

>CA264_02115 threonylcarbamoyl-AMP synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSNAAFIQIHPETPQERKIREVADILRNGGVIIYPTDTIYGLGCDIHNARAIERVCQIKG
VKPDKVNLSFICSDLTHISDYAKVDTPTYKVMKKALPGPFTFVLDATSNVPKYASAKKKT
VGIRVPDNKIALQLVKELGNPILSTSIRDEDEVLEYSTDPELIYEKYRNLVDAVVDGGYG
NNIASTVVDVTNNFEVLREGAGDIEQYL