Protein Info for CA264_02110 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: lauroyl acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 16 to 294 (279 residues), 133.3 bits, see alignment E=5.3e-43

Best Hits

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN62 at UniProt or InterPro

Protein Sequence (306 amino acids)

>CA264_02110 lauroyl acyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKSTDIPPLYYPLWLLLKGLAALPLPVLYVLADFLYLLMYRVVGYRKKVVLQNLRMAFP
EKSETELRSIAKAFYRQFADVVVEILHLAGMSRSEMQRRVKFTNPELLAGYVEAGTPVLI
LGSHVGNWEWSLSAAAVTFGFPSEGVYKPLNNPFFEAFMRHTRSRLGAHLIKMKETLREF
VSKRRQPRVVALLSDQTPLRSEITFWTQFMHQDTPFYTGAEKLSERFGYPVLFLDVKRTS
RGHYALTFEQITDGKQKPAVAAEDHPITVAFAQKLEAALRRAPADYLWTHKRWKHKRPQP
AASEEL