Protein Info for CA264_00925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF17773: UPF0176_N" amino acids 6 to 96 (91 residues), 92.2 bits, see alignment E=3.4e-30 PF00581: Rhodanese" amino acids 116 to 208 (93 residues), 58.2 bits, see alignment E=1.4e-19 PF12368: Rhodanese_C" amino acids 219 to 285 (67 residues), 70.5 bits, see alignment E=1.8e-23

Best Hits

Swiss-Prot: 72% identical to Y2691_CYTH3: UPF0176 protein CHU_2691 (CHU_2691) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K07146, UPF0176 protein (inferred from 70% identity to mtt:Ftrac_3590)

Predicted SEED Role

"Rhodanese domain protein UPF0176, Firmicutes subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMP7 at UniProt or InterPro

Protein Sequence (322 amino acids)

>CA264_00925 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MNKTHSILLYYCYAPIEDPEAFREQHHLLCLELNLLGRIIVSKEGLNGTISGLIEDCEKY
MAAMHADPRFAKTDFKVDYSDKHAFTKLHVRTKAEIVHSGLLHIDPNTRTGKHLAPKEFK
EMKDRDDVVVLDVRSDYEHSVGRFKNAVTLDIENFREFPEKVNELKEKYKDKKILTYCTG
GIKCEKASAFLLEQGFEDVYQLHGGIIKYGMEAGGEDFEGKCYVFDNRVAVDVNTVNPTV
ISRCHVCDTVSDRMVNCANPVCNLHVPICEACGWELDGACSTECKEHPEKRPYDGTGYYQ
KELNGYNPLKGFNRKKKTDVQV