Protein Info for BNILDI_22955 in Escherichia coli ECRC62

Name: adrA
Annotation: diguanylate cyclase AdrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 106 to 135 (30 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details PF05230: MASE2" amino acids 40 to 128 (89 residues), 105 bits, see alignment E=1.7e-34 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 206 to 370 (165 residues), 216.4 bits, see alignment E=1e-68 PF00990: GGDEF" amino acids 211 to 366 (156 residues), 160.1 bits, see alignment E=4.1e-51

Best Hits

Swiss-Prot: 99% identical to DGCC_ECOLI: Probable diguanylate cyclase DgcC (dgcC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b0385)

MetaCyc: 99% identical to diguanylate cyclase DgcC (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"Protein YaiC"

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>BNILDI_22955 diguanylate cyclase AdrA (Escherichia coli ECRC62)
MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPRAVGLAGMFLPIASTL
VSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKTDAVLAGMWVGVMGVNV
LPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGITVSFNSAPLEWWLSLPI
IVVYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRRHWETMLRNEFDNCRRHNR
DATLLIINIDHFKSINDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGGDEFAVIMSGT
PAESAITAMLRVREGLNTLRLPNTPQVTLRISVGVAPLNPQMSHYREWLKSADLALYKAK
KAGRNRTEVAA