Protein Info for BNILDI_22085 in Escherichia coli ECRC62

Name: cusF
Annotation: Cu(+)/Ag(+) efflux RND transporter periplasmic metallochaperone CusF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF11604: CusF_Ec" amino acids 39 to 106 (68 residues), 82.3 bits, see alignment E=9.4e-28

Best Hits

Swiss-Prot: 99% identical to CUSF_ECOL6: Cation efflux system protein CusF (cusF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07810, Cu(I)/Ag(I) efflux system periplasmic protein CusF (inferred from 98% identity to eco:b0573)

MetaCyc: 98% identical to copper/silver export system periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-90; TRANS-RXN0-280

Predicted SEED Role

"Cation efflux system protein CusF precursor" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>BNILDI_22085 Cu(+)/Ag(+) efflux RND transporter periplasmic metallochaperone CusF (Escherichia coli ECRC62)
MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVKGVDLESKKITIHHDP
IAAVNWPEMTMRFTITSQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ