Protein Info for BNILDI_21675 in Escherichia coli ECRC62

Name: hscC
Annotation: molecular chaperone HscC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 PF06723: MreB_Mbl" amino acids 7 to 339 (333 residues), 45.8 bits, see alignment E=4e-16 PF00012: HSP70" amino acids 7 to 539 (533 residues), 379.6 bits, see alignment E=2.4e-117

Best Hits

Swiss-Prot: 99% identical to HSCC_ECOLI: Chaperone protein HscC (hscC) from Escherichia coli (strain K12)

KEGG orthology group: K04045, molecular chaperone HscC (inferred from 99% identity to eco:b0650)

Predicted SEED Role

"Chaperone protein DnaK" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (556 amino acids)

>BNILDI_21675 molecular chaperone HscC (Escherichia coli ECRC62)
MDNAELAIGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISMDENNHILVGKPAVSR
RTSHPDKTAALFKRAMGSNTNWRLGSDTFNAPELSSLVLRSLKEDAEEFLQRPIKDVVIS
VPAYFSDEQRKHTRLAAELAGLNAVRLINEPTAAAMAYGLHTQQNTRSLVFDLGGGTFDV
TVLEYATPVIEVHASAGDNFLGGEDFTHMLVDDVLKRADVTRTTLNESELAALYACVEAA
KCSNQSPLHIRWQYQDEARECEFYENELEDLWLPLLNRLRVPIEQALRDARLKPSQIDSL
VLVGGASQMPLVQRIAVRLFGKLPYQSYDPSTIVALGAAIQAACRLRSEDIEEVILTDIC
PYSLGVEVNRQGVSGIFSPIIERNTTVPVSRVETYSTMHPEQDSITVNVYQGENHKVKNN
ILVESFDVPLKKTGAYQSIDIRFSYDINGLLEVDVLLEDGSVKSRVINHSPVTLSAQQIE
ESRTRLSALKIYPRDMLINRTFKAKLEELWARALGDEREEIGRVITDFDAALQSNDMARV
DEVRRRASDYLAIEIP