Protein Info for BNILDI_21115 in Escherichia coli ECRC62

Name: modC
Annotation: molybdenum ABC transporter ATP-binding protein ModC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 83 to 108 (26 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 12 to 221 (210 residues), 236.9 bits, see alignment E=8.8e-75 PF00528: BPD_transp_1" amino acids 26 to 218 (193 residues), 70.3 bits, see alignment E=9.3e-24

Best Hits

Swiss-Prot: 100% identical to MODB_ECOLI: Molybdenum transport system permease protein ModB (modB) from Escherichia coli (strain K12)

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to eco:b0764)

MetaCyc: 100% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>BNILDI_21115 molybdenum ABC transporter ATP-binding protein ModC (Escherichia coli ECRC62)
MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKALLDSVLHLPLVLPPV
VVGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDV
KLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRT
IPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARISRERAGR