Protein Info for BNILDI_20915 in Escherichia coli ECRC62

Name: ybiA
Annotation: N-glycosidase YbiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 TIGR02464: conserved hypothetical protein" amino acids 6 to 145 (140 residues), 167.8 bits, see alignment E=1.1e-53 PF08719: NADAR" amino acids 8 to 145 (138 residues), 134.4 bits, see alignment E=2.3e-43

Best Hits

Swiss-Prot: 99% identical to RIBX_SHIBS: N-glycosidase YbiA (ybiA) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K09935, hypothetical protein (inferred from 99% identity to eco:b0798)

MetaCyc: 99% identical to N-glycosidase YbiA (Escherichia coli K-12 substr. MG1655)
RXN-19407

Predicted SEED Role

"Uncharacterized domain COG3236 / GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>BNILDI_20915 N-glycosidase YbiA (Escherichia coli ECRC62)
MQDTIINFYSTSDDYGDFSNFAAWPIKVDGKTWPTSEHYFQAQKFLDEKYREEIRRVSSP
MVAARMGRDRSKPLRKNWESVKEQVMRKALRAKFEQHPELRALLLATAPAKLVEHTENDA
YWGDGGNGKGKNRLGYLLMELREQLAIEK