Protein Info for BNILDI_20690 in Escherichia coli ECRC62

Name: rimO
Annotation: 30S ribosomal protein S12 methylthiotransferase RimO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 9 to 438 (430 residues), 367.6 bits, see alignment E=8.1e-114 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 9 to 438 (430 residues), 672.5 bits, see alignment E=3e-206 PF00919: UPF0004" amino acids 9 to 96 (88 residues), 76.2 bits, see alignment E=2.6e-25 PF04055: Radical_SAM" amino acids 145 to 323 (179 residues), 90.9 bits, see alignment E=1.6e-29 PF18693: TRAM_2" amino acids 379 to 441 (63 residues), 75 bits, see alignment E=6.2e-25

Best Hits

Swiss-Prot: 100% identical to RIMO_ECOSE: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Escherichia coli (strain SE11)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 100% identity to eco:b0835)

MetaCyc: 100% identical to ribosomal protein S12 methylthiotransferase RimO (Escherichia coli K-12 substr. MG1655)
RXN0-6366 [EC: 2.8.4.4]

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>BNILDI_20690 30S ribosomal protein S12 methylthiotransferase RimO (Escherichia coli ECRC62)
MSKVTPQPKIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAV
QESLEAIGEALNENGKVIVTGCLGAKEDQIREVHPKVLEITGPHSYEQVLEHVHHYVPKP
KHNPFLSLVPEQGVKLTPRHYAYLKISEGCNHRCTFCIIPSMRGDLVSRPIGEVLSEAKR
LVDAGVKEILVISQDTSAYGVDVKHRTGFHNGEPVKTSMVSLCEQLSKLGIWTRLHYVYP
YPHVDDVIPLMAEGKILPYLDIPLQHASPRILKLMKRPGSVDRQLARIKQWREICPELTL
RSTFIVGFPGETEEDFQMLLDFLKEARLDRVGCFKYSPVEGADANALPDQVPEEVKEERW
NRFMQLQQQISAERLQEKVGREILVIIDEVDEEGAIGRSMADAPEIDGAVYLNGETNVKP
GDILRVKVEHADEYDLWGSRV