Protein Info for BNILDI_20160 in Escherichia coli ECRC62

Name: ssuC
Annotation: aliphatic sulfonate ABC transporter permease SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 247 (168 residues), 109.7 bits, see alignment E=7.6e-36

Best Hits

Swiss-Prot: 100% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to eco:b0934)

MetaCyc: 100% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>BNILDI_20160 aliphatic sulfonate ABC transporter permease SsuC (Escherichia coli ECRC62)
MATPVKKWLLRVAPWFLPVGIVAVWQLASSVGWLSTRILPSPEGVVTAFWTLSASGELWQ
HLAISSWRALIGFSIGGSLGLILGLISGLSRWGERLLDTSIQMLRNVPHLALIPLVILWF
GIDESAKIFLVALGTLFPIYINTWHGIRNIDRGLVEMARSYGLSGIPLFIHVILPGALPS
IMVGVRFALGLMWLTLIVAETISANSGIGYLAMNAREFLQTDVVVVAIILYALLGKLADV
SAQLLERLWLRWNPAYHLKEATV