Protein Info for BNILDI_20090 in Escherichia coli ECRC62

Annotation: capsular biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 200 to 231 (32 residues), see Phobius details amino acids 247 to 272 (26 residues), see Phobius details amino acids 298 to 301 (4 residues), see Phobius details amino acids 310 to 314 (5 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 428 to 447 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecl:EcolC_3177)

Predicted SEED Role

"FIG01200177: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>BNILDI_20090 capsular biosynthesis protein (Escherichia coli ECRC62)
MTLNTGFYLQIYTFITLILCGLVQYFTGMQAVLWLPFCLALVMVGLLVMQTRDGTQGLDD
QETIILAVYCSFLALVGLSTLIQGGPVVAIIAFKNEIGLSLVMICLLLGFCRESQIYRVT
RCLYWVFYAQIPVMFYQVFFVVPQRVALLGEDEKWDSVVGTFGGDPMGGGNTAAMGLFCL
LIMLLKLSEYKHGLTTIKSLVLHIILGLGLCIIGEVKFVILLSPLFLAWVWVTPGYVKDI
SKVNLKALLVIILGMVLLITLAIVILASFYSAAFGTDPTQSSLSVFWESLSYIFDPNYIL
STGELGRFTTLFFWWENNDLLGISGTLFGYGLNATNSGSSVSPGFLNLIYNLILDSTSLS
MLLWEVGVIGTVLFIGLFIFILKVTQAKPVLRLEQLDQQDLQLVSFAPAYNAFVISCLLS
IPYSQILMITPMLQFLFYLSLGCSLVIRRTVLRSVESLYEQ