Protein Info for BNILDI_19765 in Escherichia coli ECRC62

Name: torR
Annotation: two-component system response regulator TorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 98.7 bits, see alignment E=2.3e-32 PF00486: Trans_reg_C" amino acids 153 to 225 (73 residues), 62.9 bits, see alignment E=2.4e-21

Best Hits

Swiss-Prot: 100% identical to TORR_ECO57: TorCAD operon transcriptional regulatory protein TorR (torR) from Escherichia coli O157:H7

KEGG orthology group: K07772, two-component system, OmpR family, torCAD operon response regulator TorR (inferred from 100% identity to eco:b0995)

Predicted SEED Role

"TorCAD operon transcriptional regulatory protein TorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>BNILDI_19765 two-component system response regulator TorR (Escherichia coli ECRC62)
MPHHIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQPVDLILLDINLPDEN
GLMLTRALRERSTVGIILVTGRSDRIDRIVGLEMGADDYVTKPLELRELVVRVKNLLWRI
DLARQAQPHTQDNCYRFAGYCLNVSRHTLERDGEPIKLTRAEYEMLVAFVTNPGEILSRE
RLLRMLSARRVENPDLRTVDVLIRRLRHKLSADLLVTQHGEGYFLAADVC