Protein Info for BNILDI_19330 in Escherichia coli ECRC62

Name: flgI
Annotation: flagellar basal body P-ring protein FlgI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02119: FlgI" amino acids 21 to 364 (344 residues), 463.7 bits, see alignment E=1.6e-143

Best Hits

Swiss-Prot: 100% identical to FLGI_ECOUT: Flagellar P-ring protein (flgI) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K02394, flagellar P-ring protein precursor FlgI (inferred from 100% identity to eco:b1080)

Predicted SEED Role

"Flagellar P-ring protein FlgI" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>BNILDI_19330 flagellar basal body P-ring protein FlgI (Escherichia coli ECRC62)
VIKFLSALILLLVTTAAQAERIRDLTSVQGVRQNSLIGYGLVVGLDGTGDQTTQTPFTTQ
TLNNMLSQLGITVPTGTNMQLKNVAAVMVTASLPPFGRQGQTIDVVVSSMGNAKSLRGGT
LLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAVIERELPSQFG
VGNTLNLQLNDEDFSMAQQIADTINRVRGYGSATALDARTIQVRVPSGNSSQVRFLADIQ
NMQVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQANVSQPDTPFGGG
QTVVTPQTQIDLRQSGGSLQSVRSSASLNNVVRALNALGATPMDLMSILQSMQSAGCLRA
KLEII