Protein Info for BNILDI_17440 in Escherichia coli ECRC62

Name: ddpX
Annotation: D-alanyl-D-alanine dipeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF01427: Peptidase_M15" amino acids 4 to 186 (183 residues), 265 bits, see alignment E=4.6e-83 PF02557: VanY" amino acids 41 to 117 (77 residues), 26.4 bits, see alignment E=5.2e-10

Best Hits

Swiss-Prot: 100% identical to DDPX_ECOLI: D-alanyl-D-alanine dipeptidase (ddpX) from Escherichia coli (strain K12)

KEGG orthology group: K08641, D-alanyl-D-alanine dipeptidase [EC: 3.4.13.22] (inferred from 100% identity to eco:b1488)

MetaCyc: 100% identical to D-alanyl-D-alanine dipeptidase (Escherichia coli K-12 substr. MG1655)
D-Ala-D-Ala dipeptidase. [EC: 3.4.13.22]

Predicted SEED Role

"D-alanyl-D-alanine dipeptidase (EC 3.4.13.22)" (EC 3.4.13.22)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>BNILDI_17440 D-alanyl-D-alanine dipeptidase (Escherichia coli ECRC62)
MSDTTELVDLAVIFPDLEIELKYACADNITGKAIYQQARCLLHKDAITALAKSISIAQLS
GLQLVIYDAYRPQQAQAMLWQACPDPQYVVDVTVGSNHSRGTAIDLTLRDEHGNILDMGA
GFDEMHERSHAYHPSVPPAAQRNRLLLNAIMTGGGFVGISSEWWHFELPQAASYPLLADQ
FTCFISPGTQHVS