Protein Info for BNILDI_17075 in Escherichia coli ECRC62

Name: ynfD
Annotation: Uncharacterized protein YnfD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF06649: DUF1161" amino acids 26 to 79 (54 residues), 68.3 bits, see alignment E=3e-23

Best Hits

Swiss-Prot: 98% identical to YNFD_ECOLI: Uncharacterized protein YnfD (ynfD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b1586)

Predicted SEED Role

"FIG00639146: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>BNILDI_17075 Uncharacterized protein YnfD (Escherichia coli ECRC62)
MKLSTCCAALLLALASPVVLAAPGSCERIQSDISQRIINNGVPESSFTLSIVPNDQVDQP
DSQVVGHCANDTHKILYTRTTSGNVSAPAQSTQDGAPAEPQ