Protein Info for BNILDI_17005 in Escherichia coli ECRC62

Name: mdtI
Annotation: multidrug/spermidine efflux SMR transporter subunit MdtI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 6 to 99 (94 residues), 99.9 bits, see alignment E=4.8e-33

Best Hits

Swiss-Prot: 100% identical to MDTI_ECODH: Spermidine export protein MdtI (mdtI) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K11742, spermidine export protein MdtI (inferred from 100% identity to eco:b1599)

MetaCyc: 100% identical to multidrug/spermidine efflux pump membrane subunit MdtI (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-350; TRANS-RXN0-266

Predicted SEED Role

"Spermidine export protein MdtI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>BNILDI_17005 multidrug/spermidine efflux SMR transporter subunit MdtI (Escherichia coli ECRC62)
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID
LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA