Protein Info for BNILDI_16965 in Escherichia coli ECRC62

Name: ydgC
Annotation: Inner membrane protein YdgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 47 (17 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details PF06942: GlpM" amino acids 5 to 111 (107 residues), 174.7 bits, see alignment E=2.9e-56

Best Hits

Swiss-Prot: 100% identical to YDGC_ECO57: Inner membrane protein YdgC (ydgC) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b1607)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (111 amino acids)

>BNILDI_16965 Inner membrane protein YdgC (Escherichia coli ECRC62)
MGLVIKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRATII
FSMWSIIPYFVYLVSLWYFTGMMRLPAAFVGSVACWGISAWVLIICWIKLH