Protein Info for BNILDI_16835 in Escherichia coli ECRC62

Name: nth
Annotation: endonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR01083: endonuclease III" amino acids 4 to 194 (191 residues), 300 bits, see alignment E=3.3e-94 PF00730: HhH-GPD" amino acids 34 to 168 (135 residues), 86.5 bits, see alignment E=2.3e-28 PF00633: HHH" amino acids 100 to 127 (28 residues), 30.2 bits, see alignment (E = 4.1e-11) PF10576: EndIII_4Fe-2S" amino acids 187 to 203 (17 residues), 23.8 bits, see alignment (E = 6.8e-09)

Best Hits

Swiss-Prot: 100% identical to END3_ECOLI: Endonuclease III (nth) from Escherichia coli (strain K12)

KEGG orthology group: K10773, endonuclease III [EC: 4.2.99.18] (inferred from 100% identity to eco:b1633)

MetaCyc: 100% identical to endonuclease III (Escherichia coli K-12 substr. MG1655)
DNA-(apurinic or apyrimidinic site) lyase. [EC: 4.2.99.18]; 4.2.99.18 [EC: 4.2.99.18]; 4.2.99.18 [EC: 4.2.99.18]

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>BNILDI_16835 endonuclease III (Escherichia coli ECRC62)
MNKAKRLEILTRLRENNPHPTTELNFSSPFELLIAVLLSAQATDVSVNKATAKLYPVANT
PAAMLELGVEGVKTYIKTIGLYNSKAENIIKTCRILLEQHNGEVPEDRAALEALPGVGRK
TANVVLNTAFGWPTIAVDTHIFRVCNRTQFAPGKNVEQVEEKLLKVVPAEFKVDCHHWLI
LHGRYTCIARKPRCGSCIIEDLCEYKEKVDI